PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4KG121700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 164aa    MW: 17498.7 Da    PI: 4.5519
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4KG121700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB796.4e-251811797
                NF-YB 17 mkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97
                         m++  P n+ki+ dake v++c +ef + +   a + c++++r t++gddl+ al++lGf+d v  l +yl++yre+eg +
  Pavir.4KG121700.1.p  1 MRHGSPPNSKIAGDAKEAVDNCLAEFSAVLIRAAVEECRQDRRTTVTGDDLILALSNLGFDDNVRLLALYLRRYREIEGTR 81
                         78888*************************************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF008082.0E-9155IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene3DG3DSA:1.10.20.109.1E-20286IPR009072Histone-fold
SuperFamilySSF471134.38E-16383IPR009072Histone-fold
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 164 aa     Download sequence    Send to blast
MRHGSPPNSK IAGDAKEAVD NCLAEFSAVL IRAAVEECRQ DRRTTVTGDD LILALSNLGF  60
DDNVRLLALY LRRYREIEGT RPRARHTLMV ALEHPTAPAV EVEVQSPAPA SPGLDLQLGP  120
PQVRDITELG PHADVCAVWR AADAAAAAGT LKAPTGVDDE DEE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A7e-201761893NF-YB
4awl_B7e-201761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A7e-201761994NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012700681.16e-63PREDICTED: nuclear transcription factor Y subunit B-1-like
TrEMBLK3Y1032e-62K3Y103_SETIT; Uncharacterized protein
STRINGSi007865m5e-62(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP140561326
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.34e-17nuclear factor Y, subunit B8